@ARTICLE{TreeBASE2Ref22363,
author = {Alberto Cenci and Valentin Guignon and Nicolas Roux and Mathieu Rouard},
title = {Genomic analysis of NAC transcription factors in banana (Musa acuminata) and definition of NAC orthologous groups for monocots and dicots},
year = {2013},
keywords = {NAC transcription factors},
doi = {},
url = {http://},
pmid = {},
journal = {Plant Molecular Biology},
volume = {},
number = {},
pages = {},
abstract = {Identifying the molecular mechanisms underlying tolerance to abiotic stresses is important in crop breeding. A comprehensive understanding of the gene families associated with drought tolerance is therefore highly relevant. NAC transcription factors are a large plant-specific gene family involved in the regulation of tissue development and responses to biotic and abiotic stresses. The main goal of this study was to set up a framework of Orthologous Groups (OGs) determined by an expert sequence comparison of NAC genes from both monocots (O. sativa and Musa acuminata) and dicots (V. vinifera and A. thaliana). In order to clarify the orthologous relationships among NAC genes of different species, we performed an in-depth comparative study of four divergent taxa, in dicots and monocots, whose genomes already been completely sequenced: Arabidopsis thaliana, Vitis vinifera, Musa acuminata and Oryza sativa. Due to independent evolution, NAC copy number is highly variable in these plant genomes. Based on an expert NAC sequence comparison, we propose forty orthologous groups of NAC sequences that were probably derived from an ancestor gene present in the most recent common ancestor of dicots and monocots. These orthologous groups provide a curated resource for large-scale protein sequence annotation of NAC transcription factors. The established orthology relationships also provide a useful reference for NAC function studies in newly sequenced genomes such as Musa acuminata and other plant species. }
}
Matrix 18561 of Study 14688
Citation title:
"Genomic analysis of NAC transcription factors in banana (Musa acuminata) and definition of NAC orthologous groups for monocots and dicots".
Study name:
"Genomic analysis of NAC transcription factors in banana (Musa acuminata) and definition of NAC orthologous groups for monocots and dicots".
This study is part of submission 14688
(Status: Published).
Matrices
Title: MSA OG1c
Rows
Taxon Label |
Row Segments |
Characters 1?–30 |
Arabidopsis thaliana ANAC038 039 At2g24430 1 |
(none)
|
KEEEALPPGFRFHPTDEELISYYLVNKIFT |
Musa acuminata GSMUA Achr6T01770 001 |
(none)
|
EEEQQLPPGFRFHPTDEELITHYLTHKIFD |
Musa acuminata GSMUA Achr7T19680 001 |
(none)
|
KEEEQLPPGFRFHPTDEELITHYLTNKIFG |
Musa acuminata GSMUA Achr8T24680 001 |
(none)
|
KEEDRLPPGFRFHPTDEELIAHYLTNKMFG |
Oryza sativa Os09g32260 1 |
(none)
|
KKEESLPPGFRFHPTDEELITYYLRQKIFT |
Vitis vinifera VvNAC65 GSVIVT01035554001 |
(none)
|
RKEETLPPGFRFHPTDEELITCYLINKIFT |
Columns
None of the columns has a description.